Antibodies

View as table Download

Rabbit polyclonal Prostate Apoptosis Response Protein-4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human prostate apoptosis response protein-4.

Rabbit Polyclonal Anti-PAWR Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PAWR antibody: synthetic peptide directed towards the middle region of human PAWR. Synthetic peptide located within the following region: VNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLL

Anti-PAWR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 136-278 amino acids of human PRKC, apoptosis, WT1, regulator