Antibodies

View as table Download

Rabbit Polyclonal Anti-CARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CARS antibody: synthetic peptide directed towards the C terminal of human CARS. Synthetic peptide located within the following region: KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD

Rabbit Polyclonal Anti-CARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY

Rabbit polyclonal anti-IARS2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IARS2.

Rabbit polyclonal RARS Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RARS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 605-634 amino acids from the C-terminal region of human RARS.

Rabbit Polyclonal antibody to LARS2 (leucyl-tRNA synthetase 2, mitochondrial)

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 204 of LARS2 (Uniprot ID#Q15031)

Rabbit Polyclonal antibody to LARS2 (leucyl-tRNA synthetase 2, mitochondrial)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 458 of LARS2 (Uniprot ID#Q15031)

Rabbit Polyclonal Anti-TARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARS antibody: synthetic peptide directed towards the N terminal of human TARS. Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

Rabbit Polyclonal Anti-YARS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human YARS2