Antibodies

Jump to Filters
View as table Download
THOC3 Rabbit Polyclonal Antibody
TA343953

USD 410.00

5 Days

Rabbit Polyclonal Anti-THOC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3. Synthetic peptide located within the following region: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT