Antibodies

Jump to Filters
View as table Download
GJB1 Rabbit Polyclonal Antibody
TA341660

USD 375.00

5 Days

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR
GJB1 Rabbit Polyclonal Antibody
TA341661

USD 310.00

5 Days

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC