Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit polyclonal CYP1A2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1. |
Rabbit polyclonal Cytochrome P450 1A2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Anti-CYP1B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cytochrome P450, family 1, subfamily B, polypeptide 1 |
Germany
Japan
United Kingdom
China
