Antibodies

Jump to Filters
View as table Download
KCNMA1 Rabbit Polyclonal Antibody
TA316944

USD 425.00

5 Days

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).
Prostaglandin E Synthase (PTGES) Rabbit Polyclonal Antibody
TA317206

USD 425.00

5 Days

PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%).
Parathyroid Hormone Receptor 2 (PTH2R) Rabbit Polyclonal Antibody
TA317209

USD 425.00

5 Days

PTHR2 / PTH2R Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen PTHR2 / PTH2R antibody was raised against synthetic 20 amino acid peptide from 1st extracellular domain of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (95%).
SLC5A10 Rabbit Polyclonal Antibody
TA317338

USD 425.00

5 Days

SGLT5 / SLC5A10 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen SLC5A10 / SGLT5 antibody was raised against synthetic 18 amino acid peptide from cytoplasmic domain of human SLC5A10. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Rat, Hamster, Elephant, Pig (94%); Mouse, Dog, Bat, Bovine, Panda, Rabbit, Opossum (89%); Horse (83%).
TM9SF3 Rabbit Polyclonal Antibody
TA317428

USD 425.00

5 Days

TM9SF3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Chicken, Guinea Pig, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen TM9SF3 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus (100%); Lizard, Stickleback, Medaka (93%); Bat, Salmon, Zebrafish, Eye worm, Tick (87%); Pufferfish, Drosophila, Water flea, Nematode (80%).
TM9SF3 Rabbit Polyclonal Antibody
TA317429

USD 425.00

5 Days

TM9SF3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen TM9SF3 antibody was raised against synthetic 17 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Pufferfish, Zebrafish (100%); Salmon, Stickleback (94%); Opossum, Seq squirt (82%).
TMEM33 Rabbit Polyclonal Antibody
TA317436

USD 425.00

5 Days

TMEM33 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen TMEM33 antibody was raised against synthetic 18 amino acid peptide from internal region of human TMEM33. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Elephant, Panda, Horse, Pig, Opossum, Platypus (100%); Mouse, Rat, Hamster, Rabbit, Turkey, Chicken, Lizard, Xenopus, Zebrafish (94%); Catfish, Salmon, Stickleback, Sea anemone (89%); Drosophila (83%).
WNT7A Rabbit Polyclonal Antibody
TA317522

USD 425.00

5 Days

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).
NPFF1 Receptor (NPFFR1) Rabbit Polyclonal Antibody
TA317553

USD 425.00

5 Days

NPFF1 / NPFFR1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen NPFFR1 / GPR147 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human NPFF1 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit, Pig (100%); Mouse, Rat, Dog, Panda (95%); Elephant, Turkey, Chicken (85%); Opossum, Platypus (80%).
TM7SF1 (GPR137B) Rabbit Polyclonal Antibody
TA317615

USD 425.00

5 Days

GPR137B Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen GPR137B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPR137B / TM7SF1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Horse, Rabbit, Pig, Opossum (100%); Hamster, Elephant, Bovine (94%); Goat, Chicken, Lizard (88%); Dog, Bat, Turkey (81%).
Cannabinoid Receptor II (CNR2) Rabbit Polyclonal Antibody
TA317640

USD 425.00

5 Days

CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%).
alpha 1b Adrenergic Receptor (ADRA1B) Rabbit Polyclonal Antibody
TA317665

USD 425.00

5 Days

Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%).
KCNH2 Rabbit Polyclonal Antibody
TA317965

USD 425.00

5 Days

KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%).
CD70 Rabbit Polyclonal Antibody
TA318843

USD 425.00

5 Days

CD70 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen CD27L / CD70 antibody was raised against synthetic 17 amino acid peptide from internal region of human CD70. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset (94%); Bovine, Rabbit (82%).
ENTPD2 Rabbit Polyclonal Antibody
TA318850

USD 425.00

5 Days

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen ENTPD2 antibody was raised against synthetic 17 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Panda, Dog, Horse (94%); Marmoset, Mouse, Rat, Hamster, Elephant, Bovine (88%); Opossum, Xenopus (82%).
HSD3B2 Rabbit Polyclonal Antibody
TA334658

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
Bestrophin 2 (BEST2) Rabbit Polyclonal Antibody
TA316564

USD 425.00

5 Days

BEST2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Hamster, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen BEST2 / Bestrophin-2 antibody was raised against synthetic 17 amino acid peptide from internal region of human BEST2 / Bestrophin-2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Bovine, Pig (100%); Panda, Dog, Bat, Rabbit, Opossum (94%); Marmoset (88%).
BEST4 Rabbit Polyclonal Antibody
TA316566

USD 425.00

5 Days

BEST4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Gorilla, Human, Pig, Rabbit
Conjugation Unconjugated
Immunogen BEST4 antibody was raised against synthetic 18 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Bat, Rabbit, Pig (100%); Marmoset, Rat, Horse (94%); Dog (89%); Panda, Lizard (83%).
MUPCDH (CDHR5) Rabbit Polyclonal Antibody
TA316615

USD 425.00

5 Days

CDHR5 / MUCDHL Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Human, Monkey, Rabbit, Gorilla, Pig
Conjugation Unconjugated
Immunogen CDHR5 / MUCDHL antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human CDHR5 / MUPCDH. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine, Elephant, Panda, Rabbit, Pig (100%).
DRD2
TA316681

USD 484.00

5 Days

Dopamine D2 Receptor (Cytoplasmic Domain) rabbit polyclonal antibody, Immunoaffinity purified

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Dog, Gorilla, Human, Rabbit, Horse (Predicted: Monkey, Pig)
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Ferret, Bat, Bovine, Dog, Elephant, Panda, Horse, Rabbit (100%); Gibbon, Monkey, Pig (94%); Marmoset (81%).
Dopamine Receptor D3 (DRD3) Rabbit Polyclonal Antibody
TA316683

USD 425.00

5 Days

Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig
Conjugation Unconjugated
Immunogen DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Marmoset, Mouse, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Rat, Rabbit (94%); Elephant (89%).
Dopamine Receptor D5 (DRD5) Rabbit Polyclonal Antibody
TA316684

USD 425.00

5 Days

DRD5 / Dopamine Receptor D5 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Human
Conjugation Unconjugated
Immunogen DRD5 / Dopamine Receptor D5 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD5 / Dopamine Receptor D5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog (100%); Marmoset, Panda, Horse (94%); Mouse, Bovine, Hamster, Elephant, Pig (88%); Rat, Rabbit (81%).
ENPP3 Rabbit Polyclonal Antibody
TA316704

USD 425.00

5 Days

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Dog, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%).
ENPP3 Rabbit Polyclonal Antibody
TA316706

USD 425.00

5 Days

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%).
ENPP3 Rabbit Polyclonal Antibody
TA316707

USD 425.00

5 Days

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%).
Ghrelin Receptor (GHSR) Rabbit Polyclonal Antibody
TA316777

USD 425.00

5 Days

Ghrelin Receptor / GHSR Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen GHSR / Ghrelin Receptor antibody was raised against synthetic 13 amino acid peptide from N-terminal extracellular domain of human Ghrelin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (92%); Mouse, Rat (85%).
GLG1 Rabbit Polyclonal Antibody
TA316780

USD 425.00

5 Days

GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Galago, Elephant, Platypus, Medaka (94%); Opossum, Turkey, Zebra finch, Chicken, Stickleback, Pufferfish (89%); Xenopus, Zebrafish (83%).
GLG1 Rabbit Polyclonal Antibody
TA316781

USD 425.00

5 Days

GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Guinea pig, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen GLG1 / MG160 antibody was raised against synthetic 19 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (100%); Hamster (95%); Stickleback, Medaka, Pufferfish, Zebrafish (84%).
GLP2R Rabbit Polyclonal Antibody
TA316785

USD 425.00

5 Days

Glp-2 / GLP2R Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen GLP2R / Glp-2 antibody was raised against synthetic 16 amino acid peptide from internal region of human GLP2R. Percent identity with other species by BLAST analysis: Human, Monkey, Marmoset (100%); Gorilla, Gibbon (94%); Rat, Dog, Bovine, Elephant, Panda (81%).
GPR39 Rabbit Polyclonal Antibody
TA316832

USD 425.00

5 Days

GPR39 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Horse, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen GPR39 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human GPR39. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Horse, Rabbit (100%); Marmoset, Bovine, Panda, Turkey, Chicken (94%); Pig, Opossum (88%); Dog (81%).
GPR55 Rabbit Polyclonal Antibody
TA316838

USD 425.00

5 Days

GPR55 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR55 antibody was raised against synthetic 17 amino acid peptide from 3rd extracellular domain of human GPR55. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Hamster, Bovine, Dog, Horse (94%); Elephant, Panda, Bat (88%); Rabbit (82%).
GPR61 Rabbit Polyclonal Antibody
TA316845

USD 425.00

5 Days

GPR61 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Gorilla, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen GPR61 antibody was raised against synthetic 18 amino acid peptide from 2nd cytoplasmic domain of human GPR61. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Elephant, Panda, Horse, Pig, Opossum (100%); Hamster (94%); Lizard, Pufferfish, Zebrafish (89%); Xenopus (83%).
GPR65 Rabbit Polyclonal Antibody
TA316850

USD 425.00

5 Days

GPR65 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen GPR65 / TDAG8 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human GPR65. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Rabbit (84%).
GPR88 Rabbit Polyclonal Antibody
TA316859

USD 425.00

5 Days

GPR88 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla
Conjugation Unconjugated
Immunogen GPR88 antibody was raised against synthetic 18 amino acid peptide from 1st cytoplasmic domain of human GPR88. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Mouse, Rat, Bovine, Hamster, Panda, Rabbit, Opossum (100%); Turkey, Chicken (89%); Lizard, Xenopus (83%).
HCAR1 Rabbit Polyclonal Antibody
TA316879

USD 425.00

5 Days

FKSG80 / GPR81 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen FKSG80 / GPR81 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GPR81. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gorilla (95%); Marmoset (89%); Dog, Hamster, Elephant (84%).
KCNMA1 Rabbit Polyclonal Antibody
TA316945

USD 425.00

5 Days

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).
Estrogen induced gene 121 protein (KIAA1324) Rabbit Polyclonal Antibody
TA316950

USD 425.00

5 Days

KIAA1324 / maba1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen KIAA1324 / maba1 antibody was raised against synthetic 17 amino acid peptide from internal region of human KIAA1324. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant (94%); Galago, Panda, Dog, Horse, Opossum, Platypus (88%); Mouse, Rat, Hamster, Bat, Bovine, Pig, Lizard (82%).
P2Y9 (LPAR4) Rabbit Polyclonal Antibody
TA316967

USD 425.00

5 Days

GPR23 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen LPAR4 / GPR23 antibody was raised against synthetic 17 amino acid peptide from C-terminal cytoplasmic domain of human LPAR4 / GPR23. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Mouse, Rat, Bat, Hamster, Rabbit, Pig (94%); Monkey, Bovine, Panda, Horse (88%); Dog, Elephant (82%).
LPHN3 (ADGRL3) Rabbit Polyclonal Antibody
TA316971

USD 425.00

5 Days

Latrophilin-3 / LPHN3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Chicken, Gorilla, Horse, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen LPHN3 / Latrophilin-3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human LPHN3. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Bat, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Lizard (100%); Bovine, Platypus (95%); Gibbon (89%).
Leukotriene B4 Receptor 2 (LTB4R2) Rabbit Polyclonal Antibody
TA316982

USD 425.00

5 Days

BLT2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla
Conjugation Unconjugated
Immunogen LTB4R2 / BLT2 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human LTB4R2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Mouse, Rat, Bat (88%); Elephant (81%).
Malectin (MLEC) Rabbit Polyclonal Antibody
TA317019

USD 425.00

5 Days

KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (94%).
GPR7 (NPBWR1) Rabbit Polyclonal Antibody
TA317073

USD 425.00

5 Days

NPBWR1 / GPR7 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen NPBWR1 / GPR7 antibody was raised against synthetic 17 amino acid peptide from 2nd cytoplasmic domain of human NPBWR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Bovine, Horse, Rabbit (94%); Marmoset, Mouse, Rat (88%); Elephant (82%).
NPSR1 Rabbit Polyclonal Antibody
TA317079

USD 425.00

5 Days

NPSR1 / NPSR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Hamster, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen NPSR1 / NPSR / GPR154 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human NPSR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Elephant, Panda, Bovine, Bat, Pig, Turkey, Chicken (94%); Dog, Opossum, Lizard (89%); Horse, Platypus (83%).
OXGR1 Rabbit Polyclonal Antibody
TA317121

USD 425.00

5 Days

GPR80 / OXGR1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen GPR80 / GPR99 / OXGR1 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human OXGR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Dog, Bat, Elephant, Panda, Horse (94%); Mouse, Rat, Bovine (88%); Rabbit (81%).
OXGR1 Rabbit Polyclonal Antibody
TA317122

USD 425.00

5 Days

GPR80 / OXGR1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen GPR80 / GPR99 / OXGR1 antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human OXGR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (93%); Panda, Bovine, Dog, Bat (87%); Elephant, Horse, Rabbit (80%).
P2X3 (P2RX3) Rabbit Polyclonal Antibody
TA317123

USD 425.00

5 Days

P2X3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen P2RX3 / P2X3 antibody was raised against synthetic 15 amino acid peptide from C-terminal cytoplasmic domain of human P2RX3 / P2X3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Bat, Rabbit, Opossum (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse (87%).
P2Y10 (P2RY10) Rabbit Polyclonal Antibody
TA317128

USD 425.00

5 Days

P2Y10 / P2RY10 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla
Conjugation Unconjugated
Immunogen P2Y10 / P2RY10 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY10 / P2Y10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%).
Parathyroid Hormone Receptor 2 (PTH2R) Rabbit Polyclonal Antibody
TA317210

USD 425.00

5 Days

PTHR2 / PTH2R Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen PTHR2 / PTH2R antibody was raised against synthetic 17 amino acid peptide from C-terminus of human PTH2R / PTHR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Marmoset (88%); Bovine, Panda (82%).
RPTP mu (PTPRM) Rabbit Polyclonal Antibody
TA317227

USD 425.00

5 Days

PTPRM Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%).
QSOX2 Rabbit Polyclonal Antibody
TA317240

USD 425.00

5 Days

QSOX2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Horse, Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen QSOX2 antibody was raised against synthetic 20 amino acid peptide from internal region of human QSOX2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Bat, Horse (100%); Rat, Bovine (95%); Dog, Hamster (90%); Panda, Opossum (85%); Turkey, Chicken (80%).