Antibodies

View as table Download

OR1N1 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human
Immunogen OR1N1 antibody was raised against synthetic peptide

Rabbit Polyclonal antibody to GPR164 (olfactory receptor, family 51, subfamily E, member 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 78 and 170 of GPR164 (Uniprot ID#Q8TCB6)

OR51E1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Immunogen OR51E1 antibody was raised against synthetic 17 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Mouse, Hamster, Rabbit (88%); Gibbon, Galago, Rat (82%).

Rabbit Polyclonal anti-OR13C9 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR

Rabbit Polyclonal anti-OR13C9 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR

OR6N1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Hamster, Human, Mouse, Rabbit, Rat
Immunogen OR6N1 antibody was raised against synthetic 15 amino acid peptide from 1st extracellular domain of human OR6N1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Rabbit, Opossum (100%); Marmoset, Dog (93%); Panda, Bovine, Horse, Pig (87%).

OR2A4 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen OR2A4 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human OR2A4. Percent identity with other species by BLAST analysis: Human (100%).

Anti-CLCA4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 306-476 amino acids of Human Calcium-activated chloride channel regulator 4

Anti-CLCA4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 306-476 amino acids of human Calcium-activated chloride channel regulator 4

Rabbit Polyclonal Anti-ADCY3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ADCY3