OR1N1 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | OR1N1 antibody was raised against synthetic peptide |
OR1N1 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | OR1N1 antibody was raised against synthetic peptide |
Rabbit Polyclonal antibody to GPR164 (olfactory receptor, family 51, subfamily E, member 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 78 and 170 of GPR164 (Uniprot ID#Q8TCB6) |
OR51E1 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Immunogen | OR51E1 antibody was raised against synthetic 17 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Mouse, Hamster, Rabbit (88%); Gibbon, Galago, Rat (82%). |
Rabbit Polyclonal anti-OR13C9 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
Rabbit Polyclonal anti-OR13C9 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
OR6N1 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Hamster, Human, Mouse, Rabbit, Rat |
Immunogen | OR6N1 antibody was raised against synthetic 15 amino acid peptide from 1st extracellular domain of human OR6N1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Rabbit, Opossum (100%); Marmoset, Dog (93%); Panda, Bovine, Horse, Pig (87%). |
OR2A4 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | OR2A4 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human OR2A4. Percent identity with other species by BLAST analysis: Human (100%). |
Anti-CLCA4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 306-476 amino acids of Human Calcium-activated chloride channel regulator 4 |
Anti-CLCA4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 306-476 amino acids of human Calcium-activated chloride channel regulator 4 |
Rabbit Polyclonal Anti-ADCY3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADCY3 |