Rabbit Polyclonal Anti-TM9SF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TM9SF1 Antibody: synthetic peptide directed towards the N terminal of human TM9SF1. Synthetic peptide located within the following region: EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG |
Rabbit Polyclonal Anti-TM9SF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TM9SF1 Antibody: synthetic peptide directed towards the middle region of human TM9SF1. Synthetic peptide located within the following region: THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV |
TM9SF1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chimpanzee, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig |
| Immunogen | TM9SF1 antibody was raised against synthetic 18 amino acid peptide from internal region of human TM9SF1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Panda, Bovine, Horse, Pig (100%); Mouse, Rat, Hamster, Guinea pig (94%); Elephant (89%); Opossum (83%). |
TM9SF1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Immunogen | TM9SF1 antibody was raised against synthetic 17 amino acid peptide from N-terminus of human TM9SF1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Hamster, Panda (94%); Mouse, Rat (88%); Bovine, Horse, Pig (82%). |
TM9SF1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chimpanzee, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rat |
| Immunogen | TM9SF1 antibody was raised against synthetic 19 amino acid peptide from internal region of human TM9SF1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Pig (100%); Guinea pig, Lizard, Seabass, Stickleback, Medaka (95%); Opossum (89%). |
Germany
Japan
United Kingdom
China
