Antibodies

Jump to Filters
View as table Download
Alkaline Phosphatase (ALPP) Rabbit Polyclonal Antibody
TA346299

USD 410.00

5 Days

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
Alkaline Phosphatase (ALPP) Rabbit Polyclonal Antibody
TA349679

USD 345.00

In Stock

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPP