Antibodies

Jump to Filters
View as table Download
Retinoic Acid Receptor beta (RARB) Rabbit Polyclonal Antibody
TA312377

USD 345.00

In Stock

Rabbit polyclonal Retinoic Acid Receptor beta antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoic Acid Receptor β.
Retinoic Acid Receptor beta (RARB) Rabbit Polyclonal Antibody
AP06307PU-N

USD 370.00

2 Weeks

Retinoic Acid Receptor beta (RARB) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 321-370 of Human RARβ.
Retinoic Acid Receptor beta (RARB) Rabbit Polyclonal Antibody
TA338355

USD 375.00

5 Days

Rabbit Polyclonal Anti-RARB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RARB antibody: synthetic peptide directed towards the C terminal of human RARB. Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS