Antibodies

Jump to Filters
View as table Download
PCBP1 Rabbit Polyclonal Antibody
TA345949

USD 475.00

5 Days

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF