Antibodies

Jump to Filters
View as table Download
CHST13 Rabbit Polyclonal Antibody
TA316196

USD 345.00

In Stock

Rabbit polyclonal anti-CHST13 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST13.
SUOX Rabbit Polyclonal Antibody
TA308158

USD 415.00

5 Days

Rabbit Polyclonal antibody to SUOX (sulfite oxidase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 291 of SUOX (Uniprot ID#P51687)
LOC105369243 (N-term) Rabbit Polyclonal Antibody
AP54102PU-N

USD 450.00

2 Weeks

LOC105369243 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 78-107 amino acids from the N-terminal region of human SULT1A3/SULT1A4
SULT1A1 Rabbit Polyclonal Antibody
TA331008

USD 375.00

5 Days

Rabbit polyclonal Anti-SULT1A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SULT1A1 antibody: synthetic peptide directed towards the N terminal of human SULT1A1. Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
Estrogen Sulfotransferase (SULT1E1) Rabbit Polyclonal Antibody
TA322612

USD 345.00

4 Weeks

Anti-SULT1E1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 194 amino acids of human sulfotransferase family 1E, estrogen-preferring, member 1
PAPSS1 Rabbit Polyclonal Antibody
TA349567

USD 345.00

In Stock

Rabbit Polyclonal Anti-PAPSS1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PAPSS1
SULT2B1 Rabbit Polyclonal Antibody
TA350464

USD 345.00

In Stock

Rabbit Polyclonal Anti-SULT2B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SULT2B1