Rabbit polyclonal anti-CHST13 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST13. |
Rabbit polyclonal anti-CHST13 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST13. |
Rabbit Polyclonal antibody to SUOX (sulfite oxidase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 291 of SUOX (Uniprot ID#P51687) |
LOC105369243 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 78-107 amino acids from the N-terminal region of human SULT1A3/SULT1A4 |
Rabbit polyclonal Anti-SULT1A1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SULT1A1 antibody: synthetic peptide directed towards the N terminal of human SULT1A1. Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT |
Anti-SULT1E1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 194 amino acids of human sulfotransferase family 1E, estrogen-preferring, member 1 |
Rabbit Polyclonal Anti-PAPSS1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAPSS1 |
Rabbit Polyclonal Anti-SULT2B1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SULT2B1 |