Antibodies

Jump to Filters
View as table Download
TFIIB (GTF2B) Rabbit Polyclonal Antibody
TA330172

USD 310.00

5 Days

Rabbit Polyclonal Anti-GTF2B Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the N terminal of human GTF2B. Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK
TFIIB (GTF2B) Rabbit Polyclonal Antibody
TA376846

USD 220.00

3 Weeks

GTF2B Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GTF2B (NP_001505.1).
Modifications Unmodified