Antibodies

View as table Download

Rabbit Polyclonal Anti-C4BPB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4BPB antibody: synthetic peptide directed towards the N terminal of human C4BPB. Synthetic peptide located within the following region: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV

C4BPB rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human C4BPB