Antibodies

Jump to Filters
View as table Download
NOLC1 Rabbit Polyclonal Antibody
TA339273

USD 310.00

5 Days

Rabbit Polyclonal Anti-NOLC1 Antibody

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ