Antibodies

Jump to Filters
View as table Download
Homeo box C10 (HOXC10) Rabbit Polyclonal Antibody
TA345213

USD 475.00

5 Days

Rabbit Polyclonal Anti-HOXC10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the N terminal of human HOXC10. Synthetic peptide located within the following region: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA