Antibodies

Jump to Filters
View as table Download
MASP2 Rabbit Polyclonal Antibody
TA346116

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
MASP2 Rabbit Polyclonal Antibody
TA350706

USD 345.00

In Stock

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2
MASP2 Rabbit Polyclonal Antibody
TA366823

USD 380.00

4 Weeks

MASP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2