Antibodies

Jump to Filters
View as table Download
Myelin Basic Protein (MBP) Rabbit Polyclonal Antibody
TA336053

USD 375.00

5 Days

Rabbit Polyclonal Anti-MBP Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV
Myelin Basic Protein (MBP) (C-term) Rabbit Polyclonal Antibody
AP23275PU-N

USD 405.00

2 Weeks

Myelin Basic Protein (MBP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of the human MBP
Myelin Basic Protein (MBP) Rabbit Polyclonal Antibody
TA327130

USD 345.00

3 Weeks

MBP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MBP
Mbp Rabbit Polyclonal Antibody
TA327706

USD 1,005.00

5 Days

Rabbit Polyclonal Myelin Basic Protein Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated