Antibodies

Jump to Filters
View as table Download
NDRG2 Rabbit Polyclonal Antibody
TA342551

USD 375.00

5 Days

Rabbit Polyclonal Anti-NDRG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG2 antibody: synthetic peptide directed towards the C terminal of human NDRG2. Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
NDRG2 Rabbit Polyclonal Antibody
TA321960

USD 345.00

In Stock

Anti-NDRG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-39 amino acids of Human NDRG family member 2
NDRG2 Rabbit Polyclonal Antibody
TA321961

USD 345.00

In Stock

Anti-NDRG2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-39 amino acids of Human NDRG family member 2