Antibodies

Jump to Filters
View as table Download
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA311810

USD 345.00

In Stock

Rabbit polyclonal anti-GRM7 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GRM7.
Modifications Phospho-specific
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA311811

USD 345.00

In Stock

Rabbit polyclonal anti-GluR7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GluR7.
Modifications Phospho-specific
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA347392

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-mGluR7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-mGluR7 Antibody: A synthesized peptide derived from human mGluR7
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA342670

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRM7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM7 antibody: synthetic peptide directed towards the C terminal of human GRM7. Synthetic peptide located within the following region: HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS