Antibodies

Jump to Filters
View as table Download
CTDSPL Rabbit Polyclonal Antibody
TA346421

USD 475.00

5 Days

Rabbit Polyclonal Anti-CTDSPL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
CTDSPL (N-term) Rabbit Polyclonal Antibody
AP51119PU-N

USD 450.00

2 Weeks

CTDSPL (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 4-34 amino acids from the N-terminal region of Human CTDSPL.