Antibodies

Jump to Filters
View as table Download
PDK1 Rabbit Polyclonal Antibody
TA326285

USD 345.00

4 Weeks

Rabbit polyclonal PDK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PDK1.
PDK1 Rabbit Polyclonal Antibody
TA329402

USD 375.00

5 Days

Rabbit Polyclonal anti-PDK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDK1 antibody: synthetic peptide directed towards the middle region of human PDK1. Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY