Antibodies

Jump to Filters
View as table Download
Proteinase Activated Receptor 4 (F2RL3) Rabbit Polyclonal Antibody
TA314846

USD 345.00

In Stock

Rabbit polyclonal anti-PAR4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PAR4.
Proteinase Activated Receptor 4 (F2RL3) Rabbit Polyclonal Antibody
TA314845

USD 345.00

4 Weeks

Rabbit polyclonal PAR4 (Cleaved-Gly48) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR4.
Proteinase Activated Receptor 4 (F2RL3) Rabbit Polyclonal Antibody
TA332098

USD 375.00

5 Days

Rabbit Polyclonal Anti-F2RL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-F2RL3 Antibody is: synthetic peptide directed towards the C-terminal region of Human F2RL3. Synthetic peptide located within the following region: LNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTH
Proteinase Activated Receptor 4 (F2RL3) Rabbit Polyclonal Antibody
TA376061

USD 220.00

3 Weeks

F2RL3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human F2RL3 (NP_003941.2).
Modifications Unmodified