Rabbit Polyclonal Anti-FBXO17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FBXO17 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO17. Synthetic peptide located within the following region: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA |
Rabbit Polyclonal FBG4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide contianing residues 70-85 (LQLARDRSAEGRALYA) of the human FBG4 protein. There is 100% sequence identity between the immunogen and mouse and rat sequences. |
Germany
Japan
United Kingdom
China