Antibodies

Jump to Filters
View as table Download
Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody
TA335246

USD 375.00

5 Days

Rabbit Polyclonal Anti-TPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS
TAT Rabbit Polyclonal Antibody
TA323688

USD 345.00

In Stock

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase