Antibodies

View as table Download

Rabbit Polyclonal Anti-PVRL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the N terminal of human PVRL3. Synthetic peptide located within the following region: SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAI

Rabbit Polyclonal Anti-PVRL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the middle region of human PVRL3. Synthetic peptide located within the following region: PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM

Rabbit Polyclonal Anti-PVRL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PVRL3