Antibodies

View as table Download

Rabbit Polyclonal Anti-CHRM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CHRM1

Rabbit anti-CHRM1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRM1

Rabbit polyclonal anti-CHRM1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHRM1.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CHRM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRM1 antibody is: synthetic peptide directed towards the C-terminal region of Human CHRM1. Synthetic peptide located within the following region: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI