Antibodies

View as table Download

Rabbit Polyclonal antibody to PCAF (K(lysine) acetyltransferase 2B)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 767 and 832 of PCAF (Uniprot ID#Q92831)

Rabbit Polyclonal Anti-PCAF Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCAF antibody: synthetic peptide directed towards the C terminal of human PCAF. Synthetic peptide located within the following region: PGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSI

Rabbit Polyclonal p300/CBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human PCAF.

Rabbit Polyclonal Anti-PCAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCAF antibody: synthetic peptide directed towards the N terminal of human PCAF. Synthetic peptide located within the following region: LFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAK