Antibodies

Jump to Filters
View as table Download
Renin (REN) Rabbit Polyclonal Antibody
TA346043

USD 410.00

5 Days

Rabbit Polyclonal Anti-REN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN. Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA
Renin (REN) Rabbit Polyclonal Antibody
TA327091

USD 345.00

3 Weeks

REN Rabbit Polyclonal Antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human REN