Antibodies

View as table Download

Rabbit Polyclonal IL-15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal IL-15 antibody was raised against a 13 amino acid peptide near the center of human IL-15.

Anti-Human IL-15 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-15

Rabbit polyclonal Anti-IL15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL15 antibody: synthetic peptide directed towards the N terminal of human IL15. Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV