Antibodies

Jump to Filters
View as table Download
5HT7 Receptor (HTR7) (8-23) Rabbit Polyclonal Antibody
24430

USD 510.00

3 Days

5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
5HT7 Receptor (HTR7) Rabbit Polyclonal Antibody
RA24430-100

USD 490.00

2 Weeks

5HT7 Receptor (HTR7) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
5HT7 Receptor (HTR7) Rabbit Polyclonal Antibody
TA329998

USD 375.00

5 Days

Rabbit Polyclonal Anti-HTR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI
5HT7 Receptor (HTR7) Rabbit Polyclonal Antibody
TA329999

USD 310.00

5 Days

Rabbit Polyclonal Anti-HTR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI
5HT7 Receptor (HTR7) Rabbit Polyclonal Antibody
TA336340

USD 457.00

5 Days

Rabbit Polyclonal 5-HT7 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1).