Rabbit polyclonal anti-VAMP8 antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This VAMP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VAMP8. |
Rabbit Polyclonal Anti-VAMP8 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vamp8 antibody is: synthetic peptide directed towards the middle region of Rat Vamp8. Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL |
Rabbit Polyclonal Anti-STX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human STX3 |
Germany
Japan
United Kingdom
China