Antibodies

View as table Download

Rabbit Polyclonal Anti-WNT9B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B. Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD

Rabbit Polyclonal Anti-WNT9B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B. Synthetic peptide located within the following region: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA