Antibodies

Jump to Filters
View as table Download
GSTM5 Rabbit Polyclonal Antibody
TA346675

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM5 antibody: synthetic peptide directed towards the N terminal of human GSTM5. Synthetic peptide located within the following region: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK
GSTM5 (N-term) Rabbit Polyclonal Antibody
AP51967PU-N

USD 450.00

2 Weeks

GSTM5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of Human GSTM5