Antibodies

View as table Download

Rabbit Polyclonal Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1

Rabbit Polyclonal Anti-ABCC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC1

MRP1/ABCC1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2).
Modifications Unmodified