Antibodies

View as table Download

Rabbit Polyclonal Anti-AMACR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AMACR

AMACR (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 330-359 amino acids from the C-terminal region of human AMACR

Rabbit Polyclonal Anti-AMACR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP

Rabbit anti-AMACR Polyclonal Antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AMACR

AMACR rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AMACR