Antibodies

View as table Download

Rabbit Polyclonal anti-CCL16 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL16 antibody: synthetic peptide directed towards the N terminal of human CCL16. Synthetic peptide located within the following region: SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL

Rabbit Polyclonal Anti-CCL16 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL16

CCL16 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CCL16 (NP_004581.1).
Modifications Unmodified