Rabbit Polyclonal Anti-KIAA1199 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIAA1199 antibody: synthetic peptide directed towards the middle region of human KIAA1199. Synthetic peptide located within the following region: PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD |
KIAA1199 (CEMIP) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 1292-1321 amino acids from the C-terminal region of human KIAA1199 |
CEMIP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-420 of human CEMIP (NP_061159.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China