Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CEP55 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEP55. |
Antibodies
View as table Download
CEP55 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human CEP55 |
Rabbit Polyclonal Anti-CEP55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the middle region of human CEP55. Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL |
Rabbit Polyclonal Anti-CEP55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the N terminal of human CEP55. Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK |
Rabbit Polyclonal Anti-CEP55 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CEP55 |
CEP55 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CEP55 |
CEP55 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CEP55 (NP_060601.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CEP55
Applications
- WB
Antibody Hosts
- Rabbit