Rabbit Polyclonal Anti-Chondroadherin Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Chondroadherin antibody was raised against a 17 amino acid peptide near the carboxy terminus of human Chondroadherin. The immunogen is located within the last 50 amino acids of Chondroadherin. |
Rabbit Polyclonal Anti-CHAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHAD antibody: synthetic peptide directed towards the middle region of human CHAD. Synthetic peptide located within the following region: LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD |
Rabbit Polyclonal Anti-CHAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHAD antibody: synthetic peptide directed towards the middle region of human CHAD. Synthetic peptide located within the following region: VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL |
CHAD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-359 of human CHAD (NP_001258.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
