Rabbit Polyclonal Anti-CHCHD3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD3 antibody: synthetic peptide directed towards the middle region of human CHCHD3. Synthetic peptide located within the following region: LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY |
Rabbit Polyclonal Anti-CHCHD3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD3 antibody: synthetic peptide directed towards the N terminal of human CHCHD3. Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR |
CHCHD3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CHCHD3 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human CHCHD3 (NP_060282.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
