Antibodies

Jump to Filters
View as table Download
CSRP1 Rabbit Polyclonal Antibody
TA326913

USD 275.00

3 Weeks

CSRP1 Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CSRP1
CSRP1 Rabbit Polyclonal Antibody
TA311676

USD 345.00

In Stock

Rabbit polyclonal anti-CRP1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CRP1.
CSRP1 Rabbit Polyclonal Antibody
TA335760

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CSRP1 Antibody: synthetic peptide directed towards the middle region of human CSRP1. Synthetic peptide located within the following region: YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP