Antibodies

Jump to Filters
View as table Download
CXCL14 Rabbit Polyclonal Antibody
TA328274

USD 285.00

2 Weeks

Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)
CXCL14 Rabbit Polyclonal Antibody
TA330379

USD 375.00

5 Days

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE
CXCL14 Rabbit Polyclonal Antibody
TA330380

USD 310.00

5 Days

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
CXCL14 Rabbit Polyclonal Antibody
TA375242

USD 220.00

3 Weeks

CXCL14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-111 of human CXCL14 (NP_004878.2).
Modifications Unmodified