Rabbit polyclonal anti-EPB41L2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPB41L2. |
Rabbit polyclonal anti-EPB41L2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPB41L2. |
Rabbit Polyclonal Anti-EPB41L2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPB41L2 antibody: synthetic peptide directed towards the middle region of human EPB41L2. Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST |
EPB41L2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EPB41L2 (NP_001186317.1). |
Modifications | Unmodified |