Rabbit Anti-GABAA Receptor, b3 (Ser408/409) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser408/409 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-GABRB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: DIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSF |
Rabbit Polyclonal Anti-GABRB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK |
Rabbit Polyclonal Anti-GABRB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRB3 antibody: synthetic peptide directed towards the middle region of human GABRB3. Synthetic peptide located within the following region: ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA |
GABRB3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 330-460 of human GABRB3 (NP_000805.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China