Antibodies

View as table Download

Rabbit polyclonal antibody to Glutathione Peroxidase 2 (glutathione peroxidase 2 (gastrointestinal))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 54 of GPX2

Rabbit Polyclonal Anti-GPX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX2 antibody: synthetic peptide directed towards the middle region of human GPX2. Synthetic peptide located within the following region: GGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLII

GPX2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human GPX2 (NP_002074.2).