Antibodies

View as table Download

Rabbit Polyclonal Anti-Hoxd4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hoxd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd4. Synthetic peptide located within the following region: FPPCEEYLQGGYLGEQGADYYGSGAQGSDFQPPGLYPRPDFGEQPFGGGG

Rabbit Polyclonal Anti-HOXD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD4 antibody: synthetic peptide directed towards the C terminal of human HOXD4. Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

HOXD4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 194-223 amino acids from the C-terminal region of human HOXD4 / HOX4B

Rabbit Polyclonal anti-HOXD4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD4 antibody: synthetic peptide directed towards the C terminal of human HOXD4. Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL