Antibodies

View as table Download

Rabbit Polyclonal Anti-IRF8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8. Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC

Rabbit Polyclonal Anti-IRF8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8. Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC

IRF8 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

IRF8 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IRF8

IRF8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 137-426 of human IRF8 (NP_002154.1).
Modifications Unmodified