Rabbit Polyclonal Anti-KIF24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF24 antibody is: synthetic peptide directed towards the C-terminal region of Human KIF24. Synthetic peptide located within the following region: SLAEKPYCSQVDFIYRQERGGGSSFDLRKDASQSEVSGENEGNLPSPEED |
Rabbit Polyclonal Anti-KIF24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF24 antibody is: synthetic peptide directed towards the N-terminal region of Human KIF24. Synthetic peptide located within the following region: IRQNTSEKQNPWTEMEKIRVCVRKRPLGMREVRRGEINIITVEDKETLLV |
Germany
Japan
United Kingdom
China